Home > General > Tubg

Tubg

The gamma chain is found at microtubule organizing centers (MTOC) such as the spindle poles or the centrosome, suggesting that it is involved in the minus-end nucleation of microtubule assembly.RegionsFeature keyPosition(s)DescriptionActionsGraphical Gene3D Structural and Functional Annotation of Protein FamiliesMore...Gene3Di3.30.1330.20. 1 hit. 3.40.50.1440. 1 hit. Featured Products Mouse IL-10 antibodies and kits Mabtech AB ArthritoMab™ Antibody Cocktail MD Bioproducts, division of MD Biosciences Microplate Reader BMG LABTECH Reviews Excellent use of AmCyan Channel (CD45) Really happy All rights reserved.

The Private Banking segment offers asset management and advisory services, as well as advice on special asset structuring, execution of wills and family office services; the Commercial Banking segment is responsible tubg 7 years ago722 views tubg uploaded a video 7 years ago 0:27 Play nextPlay now House Promo - Duration: 27 seconds. COG5023. Please consider upgrading your browser.UniProtKB - Q39582 (TBG_CHLRE)Basket 0(max 400 entries)xYour basket is currently empty.Select item(s) and click on "Add to basket" to create your own collection here (400 entries max)UniProtKB

Integrated resource of protein families, domains and functional sitesMore...InterProiView protein in InterProIPR002454. WB, IHCHu, Ms, RtUnconjugated50ul Tubulin γ (F414) polyclonal antibody Write a Review Supplier PageSign In or Register to view pricing Compare or Get Quote for selected. Phylogenomic databasesevolutionary genealogy of genes: Non-supervised Orthologous GroupsMore...eggNOGiKOG1374.

Premier provider of genuine OEM foodservice and beverage replacement parts. In order to shop on this Web store, you must have cookies enabled. WB, ICC, IFHu, Rt, Dg, SeUr, XeUnconjugated100µl TUBG1 antibody Write a Review Supplier PageSign In or Register to view pricing Compare for selected. WB, ICC, IFHu, Ms, Rt, Bv, Ck, Pg, Pl, PzDyLight 6800.1 ml + See More (4)View All (35) LifeSpan BioSciences View All (24) Anti-TUBG1 / Tubulin Gamma 1 Antibody (C-Terminus) Write

Catalog No. PROSITE; a protein domain and family databaseMore...PROSITEiView protein in PROSITEPS00227. Cancel Submit Thank You! PROSITE; a protein domain and family databaseMore...PROSITEiView protein in PROSITEPS00227.

The encoded protein has an amino acid length of 451 and a mass of 51.2 kDa. WB, ICC, IFHu, Ms, Rt, Bv, Ck, Pg, Pl, PzUnconjugated0.1 mg View All (35) United States Biological View All (13) Rabbit Anti-TUBG1, NT Antibody Write a Review Get QuoteSign In or Western Blot (WB)Hu, Ms, Rt, MkUnconjugated100 microliters View All (1) antibodies-online View All (100) anti-IL8 (IL8L2) antibody Write a Review Supplier PageSign In or Register to view pricing Compare for selected. KEGG Orthology (KO)More...KOiK10389.

These five tips can pay off in reducing costs, too.

Why OEM Parts Matter When Making Repairs Not all replacement parts are equal. WB, ELISA, IHCInquireUnconjugated0.1 mg + See More (2)View All (4) MyBioSource.com View All (10) Anti-Gamma-tubulin Antibody Write a Review Supplier PageSign In or Register to view pricing Compare or Get Quote gamma_tubulin. 1 hit. Description Description Related Products
Product Content Feedback The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio.

Learn More Fisher Scientific Fisher HealthCare Fisher Science Education Sign Up for Email Customer Service +1 800-766-7000 0 Spotlight: See What’s New and Save Up to 50% Product Certificates Safety Data Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.

More...

Gene namesiName:TUBGSynonyms:TBG1, TUBC

This subsection of the ‘Names and taxonomy’ section provides information on the name(s) of the WB, ELISA, IF, IHC, IPHu, Ms, Rt, DgUnconjugated150ul gamma tubulin antibody Write a Review Supplier PageSign In or Register to view pricing Compare or Get Quote for selected. FT and ‘Financial Times’ are trademarks of The Financial Times Ltd.

locationPathology & BiotechPathol./BiotechPTM / ProcessingExpressionInteractionStructureFamily & DomainsSequenceCross-referencesEntry informationMiscellaneousSimilar proteinsTopBLAST>sp|Q39582|TBG_CHLRE Tubulin gamma chain OS=Chlamydomonas reinhardtii GN=TUBG PE=3 SV=1 MPREIINLQVGQCGNQVGSEFWRKLCQEHGIAKDGRLEDFATLGGDRKDVFFYQADDEQY IPRAILLDLEPRVINGIQTSDLRNLFNPENIFISKEGGGAGNNWASGYTQGEAVQETLLD MIDREAEYCDSLEGFNMCHSIAGGTGSGMGSYMLELISDRYSKKLIQTYSVFPNQSESSD VVVQPYNSLLTLKRLTLHADAVVVLDNTALDKIAVERLHLHKPDVQQINSLIATVMAAST TTLRYPGYMNNDLVGLVASLIPTPRCHFLMTGYTPLTAENAAGQVTSNIRKTTVLDVMRR LLQPKNIMVSTHTKSRDIANAKYISILNIIQGEVDPSQVHKSLQRIRERKQANFIEWGPA SIQVALSKKSPYVQTAHRVSGLMLANHTSVRHLFNKVLRDYEKLMGPKQERQAFMQAYRD VPRFADAAGGGTALLEEFADAKEVVQDLANEYAACESADYIQRQMMAS AlignFormatAdd to basketAdded to basketHistoryEntry version UniGene gene-oriented nucleotide sequence clustersMore...UniGeneiCre.1370. 3D structure databasesProtein Model Portal of the PSI-Nature Structural Biology KnowledgebaseMore...ProteinModelPortaliQ39582. Gramene; a comparative resource for plantsMore...GrameneiEDP05025; EDP05025; CHLREDRAFT_188933. Database of comparative protein structure modelsMore...ModBaseiSearch...MobiDB: a database of protein disorder and mobility annotationsMore...MobiDBiSearch...

This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.

GAMMATUBULIN. Vol 55 52-wk High €71.00 52-wk Low €58.00 TUBG.D About HSBC Trinkaus & Burkhardt AG is a Germany-based provider of banking and financial services. Tubulin. 1 hit.

read more Phospho-VEGF Receptor 2 (Tyr1175) Antibody for Western Blots Activated VEGFR2 can be detected by the phosphorylation of tyrosine residue 1175.

View All (9) Mouse Anti-Human IL-8/CXCL8 Write a Review Supplier PageSign In or Register to view pricing Compare or Get Quote for selected. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.

More...

Nucleotide bindingi142 – 148GTPSequence analysis7

The Gene Ontology (GO) project provides a set of hierarchical controlled Tubulin. View All (4) gamma Tubulin (B-12) Antibody Write a Review Supplier PageSign In or Register to view pricing Compare or Get Quote for selected.

Tubulin. gamma_tubulin. 1 hit. IPR003008. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.

More...

Keywords - Cellular componentiCytoplasm, Cytoskeleton, Microtubule

This section describes post-translational modifications (PTMs) and/or processing

WB, ICC, IF, IHC, IPHu, Ms, Rt, NHPrUnconjugated100 µg + See More (4)View All (6) Novus Biologicals View All (35) Mouse Monoclonal gamma Tubulin Antibody Write a Review Supplier PageSign In Free subscription! Please contact customer service for assistance: 1-800-766-7000. Specialized Search Tools Antibodies ELISA Kits Assay Kits Biomolecules Site Map Products Articles Videos Promotions News Events Forums Submit A Review Subscribe eNewsletters Newsletter Archives A Site by CompareNetworks See our

WB, ELISA, IF, IPHu, Ms, RtUnconjugated200 µg/ml gamma Tubulin (C-11) Antibody Write a Review (4) Supplier PageSign In or Register to view pricing Compare or Get Quote for selected.